PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR06G23100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family bZIP
Protein Properties Length: 271aa    MW: 29021.6 Da    PI: 6.2203
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR06G23100.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_126.21.7e-0896140852
                      HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                      +r   NR A r++R++Kka ++ Lee+v  L a N++L k+l++ 
  LPERR06G23100.1  96 KRPSGNRAAVRKYREKKKAHTASLEEEVVHLRALNQQLMKKLQNH 140
                      55566**********************************999874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.7E-887156IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.0E-1387157No hitNo description
PfamPF077161.2E-1491146IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.3E-893140No hitNo description
CDDcd146864.42E-12101148No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MDDGDLDFSN PDTFLCPSAV GGADPDGSCS MDSYFDDILK DTEHHACTHT HTCNPPVHDL  60
SHTHTCVHVH TKIVSAPSDD AAETADSPTE NNASKKRPSG NRAAVRKYRE KKKAHTASLE  120
EEVVHLRALN QQLMKKLQNH AALEAEVARL RCLLVDIRGR IEGEIGAFPY QRPVKNIDLV  180
SSVDQGSFLS GAQAMNSCDF RCADQMYCSP GMQVRTMGED GAVSGQVLGQ GACDVASIQC  240
MGGAKSGSTK LPVCGAMGTM PVGCMPNSEK K
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0917740.0AC091774.7 Oryza sativa chromosome 6 BAC OJ1540_H01 genomic sequence, complete sequence.
GenBankAK0716390.0AK071639.1 Oryza sativa Japonica Group cDNA clone:J023099K10, full insert sequence.
GenBankAK1039680.0AK103968.1 Oryza sativa Japonica Group cDNA clone:001-016-A09, full insert sequence.
GenBankAP0036140.0AP003614.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0481E08.
GenBankAP0037690.0AP003769.3 Oryza sativa Japonica Group genomic DNA, chromosome 6, PAC clone:P0541C02.
GenBankAP0149620.0AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642505.10.0PREDICTED: uncharacterized protein LOC4342078
RefseqXP_015642506.10.0PREDICTED: uncharacterized protein LOC4342078
SwissprotQ8VY763e-76BZP19_ARATH; Basic leucine zipper 19
TrEMBLA0A0D9WU690.0A0A0D9WU69_9ORYZ; Uncharacterized protein
STRINGBGIOSGA020526-PA0.0(Oryza sativa Indica Group)
STRINGLOC_Os06g50310.10.0(Oryza sativa Japonica Group)
STRINGORGLA06G0232500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41753572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.18e-68bZIP family protein